PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 432aa    MW: 48995.5 Da    PI: 5.3386
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005258.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-093774141954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +e+  L++++gLt +q+++WF N R +
  Aco005258.1 377 FEHflHPYPNDSEKSMLSSQTGLTRSQISNWFINARVR 414
                  554458******************************88 PP

2BELL88.47.5e-29245311672
         BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  ++ +akL+ ll+e++ rY+qy +q+ +v+ssFe+v g g+a+pYt+l  +a+SrhF +L+dai++q+
  Aco005258.1 245 NNIQAKLIALLNELETRYEQYLHQIDQVVSSFEVVSGNGAAAPYTALTIQAMSRHFANLRDAIVSQL 311
                  55579***********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.7E-24159309IPR006563POX domain
PfamPF075268.3E-35165308IPR006563POX domain
PROSITE profilePS5007111.726355418IPR001356Homeobox domain
CDDcd000865.08E-11358419No hitNo description
SMARTSM003891.3E-9358422IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.4E-27363423IPR009057Homeodomain-like
SuperFamilySSF466891.67E-16364424IPR009057Homeodomain-like
PfamPF059201.7E-17375414IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MVTKEVSENY MHDGPIRDDD LASALHWDGR NQINLIQIQL NSLPPHLDSR GQQNSDSEEN  60
IVRRRHSATR CSMNCRAGEE NGHNDCVQGC GNSLSLTLGS CLFYDPMKPF KRTQANFMGS  120
NSSLDRENLR EFDSASVDHL KHYCVFNAEK RTSSPRNTAS LSSFLQRSPY LKPAQELLDE  180
VVCVSDAIEL NVENEELNVG NEARNNELDG MDAQANDRYL KLGERIYTHK ENMPPGNQLS  240
SQDKNNIQAK LIALLNELET RYEQYLHQID QVVSSFEVVS GNGAAAPYTA LTIQAMSRHF  300
ANLRDAIVSQ LHALGESEGE QYTGNYKNFS EGRSLCRTTG EKRETLQTLG SIQIRQDWKP  360
LRGLPEDSVA LLRAWLFEHF LHPYPNDSEK SMLSSQTGLT RSQISNWFIN ARVRLWKPMI  420
EELYKEEISE Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A5e-16364422563Homeobox protein Meis2
4xrm_B5e-16364422563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008794024.11e-132PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_008794023.11e-132PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_008794022.11e-132PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_008794021.11e-132PREDICTED: BEL1-like homeodomain protein 11
TrEMBLA0A067KQR45e-78A0A067KQR4_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.32e-69BEL1-like homeodomain 10